Mouse Anti-ICEBERG (Caspase Recruitment Domain-containing Protein 18, Caspase-1 Inhibitor Iceberg, CARD18, UNQ5804/PRO19611)
ICEBERG, an inhibitor of pro-caspase-1 activation, consists essentially of only a CARD. It inhibits generation of IL-1b by interacting with caspase-1 and preventing association with RIP2. The ICEBERG functions as a competitive antagonist of RIP2/pro-caspase-1 interactions and inhibits caspase-1-dependent pro-L-1b secretion in mononuclear cells. ICEBERG is induced by proinflammatory stimuli, suggesting that it may be part of a negative feedback loop.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human ICEBERG, aa1-90 (NP_067546.1).
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human ICEBERG.
