Mouse Anti-IDI1 (Isopentenyl-diphosphate Delta-isomerase 1, Isopentenyl Pyrophosphate Isomerase 1, IPP Isomerase 1, IPPI1)
IDI1 encodes a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity. [provided by RefSeq]
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilutions
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
IPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYR
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa175-283 from human IDI1 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human IDI1.
