Mouse Anti-MDA5 (Melanoma Differentiation-associated Protein 5, MDA-5, Interferon-induced Helicase C Domain-containing Protein 1, Clinically Amyopathic Dermatomyositis Autoantigen 140kD, CADM-140 Autoantigen, Helicase with 2 CARD Domains, Helicard, Hlcd, IDDM19, Interferon-induced with Helicase C Domain Protein 1, IFIH1, MGC133047, Murabutide Down-regulated Protein, RNA Helicase-DEAD Box Protein 116, RH116)
The innate immune system detects viral infection by recognizing various viral components and triggers antiviral responses . Like the toll-like receptor 3 (TLR3), the melanoma differentiation-associated protein 5 (MDA5) recognizes double-stranded (ds) RNA, a molecular pattern associated with viral infection. MDA5, a member of the DEAD/DEAH-box RNA helicase family, consists of an amino-terminal caspase recruitment domain (CARD) and a carboxyl-terminal RNA helicase domain similar to that of the related protein RIG-1. When stimulated by dsRNA, MDA5 recruits the adaptor protein VISA and ultimately causes the activation of IRF-3 and NF-κB. MDA5 and RIG-1 recognize different types of dsRNA, with MDA5 recognizing poly (I:C). MDA5-null mice were highly susceptible to infection with picornaviruses, which possess such sequences, demonstrating the importance of MDA5 in innate immunity.
Applications
Suitable for use in ELISA and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
HVNMTPEFKELYIVRENKALQKKCADYQINGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCLFSD
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa928-1023 of human MDA5 (NM_022168; NP_071451.2) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MDA5.