128242-ML550
Clone Type
PolyclonalHost
RabbitSource
HumanConjugate
MaxLight™550Isotype
IgGGrade
Affinity PurifiedApplications
WBCrossreactivity
HuAccession #
BC046208.1, AAH46208.1Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Rabbit Anti-MDA5 (Melanoma Differentiation-associated Protein 5, MDA-5, Interferon-induced Helicase C Domain-containing Protein 1, Clinically Amyopathic Dermatomyositis Autoantigen 140kD, CADM-140 Autoantigen, Helicase with 2 CARD Domains, Helicard, Hlcd, IDDM19, Interferon-induced with Helicase C Domain Protein 1, IFIH1, MGC133047, Murabutide Down-regulated Protein, RNA Helicase-DEAD Box Protein 116, RH116) (MaxLight 550)
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
The innate immune system detects viral infection by recognizing various viral components and triggers antiviral responses . Like the toll-like receptor 3 (TLR3), the melanoma differentiation-associated protein 5 (MDA5) recognizes double-stranded (ds) RNA, a molecular pattern associated with viral infection. MDA5, a member of the DEAD/DEAH-box RNA helicase family, consists of an amino-terminal caspase recruitment domain (CARD) and a carboxyl-terminal RNA helicase domain similar to that of the related protein RIG-1. When stimulated by dsRNA, MDA5 recruits the adaptor protein VISA and ultimately causes the activation of IRF-3 and NF-κB. MDA5 and RIG-1 recognize different types of dsRNA, with MDA5 recognizing poly (I:C). MDA5-null mice were highly susceptible to infection with picornaviruses, which possess such sequences, demonstrating the importance of MDA5 in innate immunity.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAGICNFTEEDSSNSA
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length human IFIH1, aa1-221 (AAH46208.1).
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human IFIH1.