Rabbit Anti-IFITM3 (Interferon-induced Transmembrane Protein 3, Dispanin Subfamily A Member 2b, DSPA2b, Interferon-inducible Protein 1-8U) (PE)
FITM3 is a 14.6kD (predicted) member of the CD225 family of proteins. It is expressed on primordial germ cells and select tumor types, and appears to regulate cell migration. Human IFITM3 is a 133aa, two-transmembrene protein that contains an N-terminal aa1-57 and a C-terminal aa108-128 extracellular domain. Over aa3-57, human IFITM3 is 59% and 56% aa identical to bovine and mouse IFITM3, respectively. Over aa3-57 human IFITM3 is 88% identical to human IFITM2.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MSHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGGPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full-length human IFITM3, aa1-133 (NP_066362.1).
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human IFITM3.
