Mouse Anti-IPR1 (SP110, Sp110 Nuclear Body Protein, Interferon-induced Protein 41/75, Speckled 110kD, Transcriptional Coactivator Sp110)
The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. SP110 is a member of the SP100/SP140 family of nuclear body proteins and a leukocyte-specific nuclear body component. The protein can function as an activator of gene transcription and may serve as a nuclear hormone receptor coactivator. In addition, it has been suggested that the protein may play a role in ribosome biogenesis and in the induction of myeloid cell differentiation.
Applications
Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested.
Recommended Dilutions
Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
TPSDKKGKKRKRCIWSTPKRRHKKKSLPRGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEIIDGTSEMNEGKRSQKTPSTPRRVTQGAAS
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa271-380 from human SP110 (NP_004501) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SP110.
