Mouse Anti-JUN (Transcription Factor AP-1, Activator Protein 1, AP1, Proto-oncogene c-jun, V-jun Avian Sarcoma Virus 17 Oncogene Homolog, p39)
JUN is a basic domain leucine zipper protein (bZIP) that binds specific DNA sequence and belongs to AP-1 transcription factor family. It forms either heterodimer or homodimer with other transcription activator proteins such as Fos, CREB, or other JUN proteins (JunB, JunD). It is a short-lived protein with half-life of approximately 90 minutes and its gene was originally identified in ASV17 chicken retrovirus. Transcription factor activity of JUN is induced when the protein is phosphorylated on Ser63 and Ser73 residues by c-JUN N-terminal kinase (JNK). However, up-regulation of JUN is mediated by extracellular signal-regulated kinases (ERKs). In addition, normal function of JUN protein is essential for cell cycle progression and entry into the S phase.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human JUN, aa1-331 (AAH68522.1).
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human JUN.
