Mouse Anti-Kallikrein 4 (Kallikrein-4, Enamel Matrix Serine Proteinase 1, Kallikrein-like Protein 1, KLK-L1, Prostase, Serine Protease 17, EMSP1, PRSS17, PSTS) (PE)
Kallikreins are a subgroup of serine proteases and are implicated in carcinogenesis. A novel Kallikrein gene Prostase/KLK-L1 (also known as KLK4) is expressed and is up-regulated by androgens and progestins. KLK-L1 may be involved in the pathogenesis and/or progression of prostate, breast, and possibly other malignancies.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
GRMPTVLQCVNVSVVSEEVCSKLYDPLYHPSMFCAGGGQDQKDSCNGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTVQAS
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa159-254 from KLK4 (NP_004908) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human KLK4.
