Rabbit Anti-KIR2DL5 (Killer Cell Immunoglobulin-like Receptor 2DL5A, CD158f1, KIR2DL5A, CD158F, CD158F1)
KIR2DL5 is the most recently identified human killer cell immunoglobulin-like receptors (KIR), which are transmembrane glycoproteins expressed by natural killer cells (NK) and subsets of T cells. KIR2DL5 is a type II member of the KIR2D family with two extracellular Ig-like domains of the D0 and D2 type. Its structure is expressed by 50% of humans and is conserved among primate species. Its gene localized on human chromosome 19p13.3, is restricted to the B subset of KIR haplotypes. The protein is represented in the human genome by two genes, KIR2DL5A and KIR2DL5B that show 99.5-99.7% identity in their coding sequences. The protein acts as a receptor on NK cells for HLA-C alleles, inhibits the activity of NK cell and thus plays a specialized role in innate immunity.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLHILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTALSQNRVASSHVPAAGI
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human KIR2DL5A, aa1-375 (AAI60063.1).
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human KIR2DL5A.
