Rabbit Anti-Lactate Dehydrogenase (LD, LDHA, LDHB, LDH Heart Subunit, LDHH, LDH1, LDH Muscle Subunit, LDHM, NY-REN-46 Antigen, NY-REN-59 Antigen, Proliferation Inducing Gene 19 Protein, PIG19, TRG5) (Not for Export EU)
Lactate dehydrogenase (LDH) contains two isoforms in mammals, LDH-M and LDH-H, which come together to form a homotetramer of 36kD subunits. LDH is often as a marker for tissue breakdown or cytotoxicity. LDH shows cytoplasm localization.
Applications
Suitable for use in Western Blot and Immunoprecipitation. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human LDHA, aa1-332 (NP_005557.1).
Form
Supplied as a liquid.
Specificity
Recognizes human LDHA.