128992-ML650
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™650Isotype
IgG2a,kClone Number
M1Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
BC015586, AAH15586Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-LAMC1 (Laminin Subunit gamma-1, Laminin B2 Chain, Laminin-1 Subunit gamma, Laminin-10 Subunit gamma, Laminin-11 Subunit gamma, Laminin-2 Subunit gamma, Laminin-3 Subunit gamma, Laminin-4 Subunit gamma, Laminin-6 Subunit gamma, Laminin-7 Subunit gamma, Laminin-8 Subunit gamma, Laminin-9 Subunit gamma, S-laminin Subunit gamma, S-LAM gamma, Laminin B2, gamma1, LAMB2, MGC87297) (MaxLight 650)
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
Laminins are large heterotrimeric, non-collagenous glycoproteins composed of alpha, beta, and gamma chains. They are ubiquitously present in basement membrane (BM) along with entactin/nidogen (EN), collagen type IV (CIV), large heparan sulfate proteoglycan (HSPG), which interact specifically with each other to form a continuous and regular BM. Alterations of BM integrity, from local discontinuities up to complete loss, are described in many types of human and animal epithelial neoplasms.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-38 from human LAMC1 (AAH15586) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human LAMC1.
