129130-APC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
APCIsotype
IgG2a,kClone Number
4G2Grade
Affinity PurifiedApplications
FLISA IHC WBCrossreactivity
HuAccession #
NM_004524, NP_004515Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
BSA Free
Mouse Anti-LLGL2 (Lethal(2) Giant Larvae Protein Homolog 2, HGL) (APC)
Part of a complex with GPSM2/LGN, PRKCI/aPKC and PARD6B/Par-6, which may ensure the correct organization and orientation of bipolar spindles for normal cell division. This complex plays roles in the initial phase of the establishment of epithelial cell polarity.
Applications
Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
SLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPR
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa101-199 from human LLGL2 (NP_004515) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human LLGL2.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
References
1. Loss of Scribble causes cell competition in mammalian cells. Norman M, Wisniewska KA, Lawrenson K, Garcia-Miranda P, Tada M, Kajita M, Mano H, Ishikawa S, Ikegawa M, Shimada T, Fujita Y.J Cell Sci. 2012 Jan 1;125(Pt 1):59-66. Epub 2012 Jan 16. 2. Involvement of Lgl and Mahjong/VprBP in cell competition. Tamori Y, Bialucha CU, Tian AG, Kajita M, Huang YC, Norman M, Harrison N, Poulton J, Ivanovitch K, Disch L, Liu T, Deng WM, Fujita Y.PLoS Biol. 2010 Jul 13;8(7):e1000422. 3. ASPP2 Regulates Epithelial Cell Polarity through the PAR Complex. Cong W, Hirose T, Harita Y, Yamashita A, Mizuno K, Hirano H, Ohno S.Curr Biol. 2010 Jul 7. [Epub ahead of print]USBio References
No references available