129261-ML650
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™650Isotype
IgG2b,kClone Number
3G4Grade
Affinity PurifiedApplications
FLISACrossreactivity
HuAccession #
NM_002349, NP_002340Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-Lymphocyte Antigen 75 (LY75, Ly-75, C-type Lectin Domain Family 13 Member B, DEC-205, gp200-MR6, CD205, CLEC13B) (MaxLight 650)
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
CD205 is a 210kD C-type lectin transmembrane protein, known as DEC-205. It belongs to macrophage mannose receptor family and is found at high levels on dendritic cells and thymic epithelial cells. Unlike murine CD205, human CD205 is also expressed at low levels on T- and B-cells, NK cells and monocytes. CD205, serves as an endocytic receptor, functions in antigen uptake/processing and clearance of apoptotic cells.
Applications
Suitable for use in FLISA. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
TIVHGNTGKCIKPVYGWIVADDCDETEDKLWKWVSQHRLFHLHSQKCLGLDITKSVNELRMFSCDSSAMLWWKCEHHSLYGAARYRLALKDGHGTAIS
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa37-135 from human LY75 (NP_002340) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human LY75.