129285-ML550
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™550Isotype
IgG3,kClone Number
2G8Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
NM_138715, NP_619729Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-Macrophage Scavenger Receptor Type I (MSR1, CD204, Macrophage Acetylated LDL Receptor I and II, Macrophage Scavenger Receptor Types I and II, phSR1, Scavenger Receptor Class A Member 1, SCARA1, Scavenger Receptor Type A, SRA, Scvr) (MaxLight 550)
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
The murine scavenger receptor class A (SRA), type I and II is also known as CD204. CD204 is expressed by tissue macrophages and functions both as an endocytic receptor for lipoproteins and as an adhesion receptor for macrophages binding to ligand rich tissues e.g. atherosclerotic lesions. Inhibits the uptake of acetylated low-density lipoproteins and also inhibits divalent cation independent adhesion.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MEKRIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLNGKIQENTFKQQEEISKLEERVY
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa121-220 from human MSR1 (NP_619729) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MSR1.