Mouse Anti-MAFA (Transcription Factor MafA, Pancreatic beta-cell-specific Transcriptional Activator, Transcription Factor RIPE3b1, V-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog A)
MafA is a 352aa containing transcription factor playing an important part in the regulation of the insulin gene transcription. It belongs to the bZIP family and Maf subfamily with a bZIP domain and binds DNA as a homodimer. Transcription factor MafA binds to RIPE3b, a conserved enhancer element that regulates pancreatic beta cell-specific expression of the insulin gene. MafA is known to cooperate synergistically with NEUROD1 and PDX1 and is known to be up-regulated by glucose. It is detected in nuclei of pancreas islet beta cells.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Sandwich ELISA: The detection limit is ~1ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher.
AA Sequence
LEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDL
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa222-308 of human MAFA with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MAFA.
