129314
Clone Type
MonoclonalHost
MouseSource
HumanIsotype
IgG2b,kClone Number
3D12Grade
Affinity PurifiedApplications
E IF WBCrossreactivity
HuAccession #
NM_002362, NP_002353Shipping Temp
Blue IceStorage Temp
-20°CMouse Anti-MAGEA4 (Melanoma-associated Antigen 4, MAGE-4 Antigen, MAGE-X2 Antigen, MAGE-41 Antigen, Cancer/Testis Antigen 1.4, CT1.4, MAGE4, MGC21336)
MAGEA4 is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.
Applications
Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
TSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVD
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa98-171 from human MAGEA4 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MAGEA4.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
References
1. Heteroclitic serological response in esophageal and prostate cancer patients after NY?ESO?1 protein vaccination. Kawada J, Wada H, Isobe M, Gnjatic S, Nishikawa H, Jungbluth AA, Okazaki N, Uenaka A, Nakamura Y, Fujiwara S, Mizuno N, Saika T, Ritter E, Yamasaki M, Miyata H, Ritter G, Murphy R, Venhaus R, Pan L, Old LJ, Doki Y, Nakayama E.Int J Cancer. 2011 Mar 16. doi: 10.1002/ijc.26074. [Epub ahead of print]USBio References
No references available