Mouse Anti-MAP2K3 (Dual Specificity Mitogen-activated Protein Kinase Kinase 3, Mitogen-activated Protein Kinase Kinase 3, MAP Kinase Kinase 3, MAPKK 3, MKK3, MAPK/ERK Kinase 3, MEK 3, MEK3, PRKMK3, Stress-activated Protein Kinase Kinase 2, SAPK Kinase 2, SAPKK2, SAPKK-2, SKK2)
MKK3 is a protein kinase that phosphorylates the p38 MAPK. Phosphorylation by MKK3 occurs on threonine and tyrosine residues and increases the activity of p38 to stimulate transcription factors ATF2 and Elk-1. MKK3, together with MKK6, serves as upstream regulators of p38 MAPK activation. A structural variant, MKK3b, has been identified that contains 29 more aa at its N-terminus.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVN
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa1-100, from human MAP2K3 (AAH32478) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MAP2K3.