129395-ML650
Clone Type
PolyclonalHost
RabbitSource
HumanConjugate
MaxLight™650Isotype
IgGGrade
Affinity PurifiedApplications
WBCrossreactivity
HuAccession #
NM_002751.5, NP_002742.3Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Rabbit Anti-MAPK11 (Mitogen-activated Protein Kinase 11, MAP Kinase 11, MAPK 11, Mitogen-activated Protein Kinase p38 beta, MAP Kinase p38 beta, p38b, Stress-activated Protein Kinase 2b, SAPK2b, p38-2, PRKM11, SAPK2, SAPK2B) (MaxLight 650)
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
P38 beta is a member of the MAP kinase subfamily of Ser/Thr protein kinases. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by changes in osmolarity of the extracellular environment, proinflammatory cytokines and cellular stress. This protein preferentially phosphorylates transcription factor ATF2. It is activated by phosphorylation on threonine and tyrosine by MKK6, and inhibited by pyridinyl-imidazole related compounds. Highest levels of expression are found in the brain and heart, with additional expression in the placenta, lung, liver, skeletal muscle, kidney and pancreas.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length human MAPK11, aa1-364 (NP_002742.3).
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MAPK11.