129420-Biotin
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
BiotinIsotype
IgG1,kClone Number
2A4Grade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
NM_021970, NP_068805Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-MAPKSP1 (LAMTOR3, MAP2K1IP1, MAPKSP1, Ragulator Complex Protein LAMTOR3, Late Endosomal/Lysosomal Adaptor and MAPK and MTOR Activator 3, MEK-binding Partner 1, Mp1, Mitogen-activated Protein Kinase Kinase 1-interacting Protein 1, Mitogen-activated Protein Kinase Scaffold Protein 1, PRO2783) (Biotin)
MAPKSP1 (Mitogen-activated protein kinase scaffold protein 1) is a scaffold protein that functions in the extracellular signal-regulated kinase (ERK) cascade. The protein is localized to late endosomes by the mitogen-activated protein-binding protein-interacting protein, and binds specifically to MAP kinase kinase MAP2K1/MEK1, MAP kinase MAPK3/ERK1, and MAP kinase MAPK1/ERK2.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLP*
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-88 from MAPKSP1 (NP_068805) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MAPKSP1.
