129425-ML650
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™650Isotype
IgG2a,kClone Number
3D2Grade
Affinity PurifiedApplications
FLISACrossreactivity
HuAccession #
NM_017923, NP_060393Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-MARCH1 (E3 Ubiquitin-protein Ligase MARCH1, Membrane-associated RING Finger Protein 1, Membrane-associated RING-CH Protein I, MARCH-I, RING Finger Protein 171, RNF171, DKFZp564M1682, FLJ20668) (MaxLight 650)
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
E3 ubiquitin-protein ligase that mediates ubiquitination of TFRC, CD86, FAS and MHC class II proteins, such as HLA-DR alpha and beta, and promotes their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. By constitutively ubiquitinating MHC class II proteins in immature dendritic cells, down-regulates their cell surface localization thus sequestering them in the intracellular endosomal system.
Applications
Suitable for use in FLISA. Other applications not tested.
Recommended Dilutions
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
MTSSHVCCNFLNMWKKSKISTMYYLNQDAKLSNLFLQASSPTTGTAPRSQSRLSVCPSTQDICRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQWIK
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-99 from human MARCH1 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MARCH1.