129463-APC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
APCIsotype
IgG2b,kClone Number
2C7Grade
Affinity PurifiedApplications
FLISA IHC WBCrossreactivity
HuAccession #
NM_015846, NP_056671Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
BSA Free
Mouse Anti-MBD1 (Methyl-CpG-binding Domain 1, PCM1, Methyl-CpG-binding Protein MBD1, Protein Containing Methyl-CpG-binding Domain 1, CXXC-type Zinc Finger Protein 3, CXXC3, PCM1) (APC)
The MBD family of proteins includes MeCP2, MBD1, MBD2, MBD3 and MBD4. MBD1 (methyl-CpG binding domain protein 1) binds to methylated CpG sites and represses gene transcription. MBD1 is recruited to both methylated and non-methylated CpGs by separate domains: the CXXC domain targets the protein to non-methylated CpGs whereas the MBD domain targets the protein to methylated CpG. MBD1 may also interact with histone methyltransferase SETDB1 to repress transcription.
Applications
Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
HHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDE
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa415-508 from human MBD1 (NP_056671) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MBD1.
