129521-APC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
APCIsotype
IgG1,kClone Number
1A7Grade
Affinity PurifiedApplications
FLISA IHC WBCrossreactivity
HuAccession #
NM_002392, NP_002383Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
BSA Free
Mouse Anti-MDM2 (E3 Ubiquitin-protein Ligase Mdm2, Double Minute 2 Protein, Hdm2, Oncoprotein Mdm2, p53-binding Protein Mdm2) (APC)
The MDM2 (murine double minute 2) proto-oncogene was originally identified as an amplified gene in a mouse tumor cell line. Overexpression of MDM2 produces tumors in athymic mice and binds to and inactivates the transcriptional activity of the p53 protein. p53 was identified as the major target for MDM2 during embryonic development. The MDM2 gene itself is a transcriptional target for p53, and induction of p53 transcriptional activity results in increased MDM2 mRNA and protein levels. It appears that a MDM2 p53 feedback loop serves to keep the growth suppressive functions of p53 in check during the normal cell cycle. MDM2 regulates cell proliferation via p53-independent pathways and can interact with Rb, E2F-1 and DP1. Because MDM2 can bind to and inactivate the transcriptional activity of p53, Overexpression has been detected in a variety of human tumors, and appears to result from gene amplification, increased transcript level, and enhanced translation.
Applications
Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
TMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALC
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa101-200 from human MDM2 with GST-Tag. MW of the GST-Tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MDM2.
