129546-ML550
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™550Isotype
IgG2a,kClone Number
2B10Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
BC005189, AAH05189Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-MED4 (ARC36, DRIP36, VDRIP, Mediator of RNA Polymerase II Transcription Subunit 4, Activator-recruited Cofactor 36kD Component, Mediator Complex Subunit 4, TRAP/SMCC/PC2 Subunit p36 Subunit, Vitamin D3 Receptor-interacting Protein Complex 36kD Component) (MaxLight 550)
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
The Mediator is a multiprotein coactivator that is required by DNA-binding transcription factors for activation of polymerase II (see MIM 180660)-transcribed genes. MED4 appears to be a core Mediator subunit and is found in nearly all Mediator preparations (summary by Sato et al., 2004 [PubMed 15175163]).
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDGDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKEDEDDV
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa1-271 from human MED4 (AAH05189) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MED4.