Mouse Anti-MFAP-2 (Microfibrillar-associated Protein 2, Microfibril-associated Glycoprotein 1, MAGP, MAGP-1, MAGP1, MFAP2)
Along with elastin, elaunin, oxytalan, and elastin-associated proteins fibrillin-1, microfibrillar-associated glycoprotein-1 (MAGP or MFAP-2) can be found within the juxtacanalicular tissue of the inner and outer walls and within the collector channel walls of human eyes perfused at low and high pressure, among other certain human tissues. MAGP-1 (MFAP-2) is shown to play a significant role in the support and distensibility of the juxtacanalicular region of these collector channels. It is also reported to inhibit LTB-1 binding to fibrillin-1, stimulate the phosphorylation of Smad2, and thereby mediate the subsequent extracellular deposition of latent TGFbeta.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human MFAP2, aa1-183 (NP_002394.1).
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MFAP2.
