Mouse Anti-MFNG (Beta-1,3-N-acetylglucosaminyltransferase Manic Fringe, O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase)
MFNG is a 52-55kD member of the glucosyltransferase 31 family. It is a Golgi membrane protein that transfers N-acetylglucosamine to an O-linked fucose residue on Notch. Activity on Notch increases Delta-1 induced signaling while suppressing Jagged-1 signaling. MFNG is found in fetal pancreatic endocrine progenitor cells and immature ventricular zone neurons. Human MFNG is a 321aa type II transmembrane protein. It contains a short 7aa cytoplasmic region, plus a 294aa luminal domain (aa28-321). There are two potential splice variants, one that shows a 15aa substitution for aa104-321, and another that contains a three aa substitution for aa86-102. Over aa37-321, human MFNG shares 85% aa identity with mouse MFNG.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
WASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGP
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa214-291 from human MFNG (NP_002396) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MFNG.
