Mouse Anti-KAT6A (Histone Acetyltransferase KAT6A, MOZ, YBF2/SAS3, SAS2 and TIP60 Protein 3, MYST-3, Monocytic Leukemia Zinc Finger Protein, Runt-related Transcription Factor-binding Protein 2, Zinc Finger Protein 220, MOZ, MYST3, RUNXBP2, ZNF220, MGC167033)
Histone acetyltransferase that acetylates lysine residues in histone H3 and histone H4 (in vitro). Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. May act as a transcriptional coactivator for RUNX1 and RUNX2. Acetylates p53/TP53 at 'Lys-120' and 'Lys-382' and controls its transcriptional activity via association with PML.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MQLSGNGLEEQAAQHLDELLLAHTDLKSLDLSYNQLNDQADLCMGLQGFLIFHSFGGGTGSGFVSLLMKRLSVDYGKKSKLEFAICPAPQVSMAMTEPYNSILTTYTTLEHSDCAFIVNSKATYDMSAQPGHRVSHVHQPQSSGQIVSSITASL
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human MGC16703, aa1-154 (NP_659479).
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MGC16703.
