Mouse Anti-MLLT1 (ENL, LTG19, YEATS1, Protein ENL, YEATS Domain-containing Protein 1)
Chromosome band 11q23 is the site of translocations in myeloid and lymphoid acute leukemias, pediatric leukemias, and treatment-induced secondary acute myelogenous leukemia. The translocation breakpoints cluster in a restricted region of the HRX gene resulting in chimeric genes that encode an N-terminal portion of Hrx fused to various partner proteins. Myeloid/lymphoid or mixed-lineage leukemia translocated to 1 (MLLT1) is a nuclear protein with transcriptional transactivation properties that is fused to Hrx in t(11;19) leukemias. The minimal MLLT1 sequence required for transcription activation was narrowed to the C-terminal 90 amino acids.
Applications
Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
GRRSPESCSKPEKILKKGTYDKAYTDELVELHRRLMALRERNVLQQIVNLIEETGHFNVTNTTFDFDLFSLDETTVRKLQSCLEAVA
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa472-559 from human MLLT1 (NP_005925) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MLLT1.
