129791-APC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
APCIsotype
IgG1,kClone Number
3F7Grade
Affinity PurifiedApplications
FLISA IF WBCrossreactivity
HuAccession #
NM_178176, NP_835470Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
BSA Free
Mouse Anti-MOGAT3 (2-acylglycerol O-acyltransferase 3, Acyl-CoA:monoacylglycerol Acyltransferase 3, MGAT3, Diacylglycerol O-acyltransferase Candidate 7, hDC7, Diacylglycerol Acyltransferase 2-like Protein 7, Monoacylglycerol O-acyltransferase 3, DC7, DGAT2L7, UNQ9383/PRO34208, MGC119203, MGC119204) (APC)
Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Also able to catalyze the terminal step in triacylglycerol synthesis by using diacylglycerol and fatty acyl-CoA as substrates. Has a preference toward palmitoyl-CoA and oleoyl-CoA. May be involved in absorption of dietary fat in the small intestine by catalyzing the resynthesis of triacylglycerol in enterocytes.
Applications
Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Sandwich FLISA: The detection limit is ~10ng/ml as a capture antibody Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
YLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDR*
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa59-108 from human MOGAT3 (NP_835470) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MOGAT3.
