Mouse Anti-MRPS27 (28S Ribosomal Protein S27, Mitochondrial, MRP-S27, S27mt, KIAA0264, FLJ21764, FLJ23348)
Component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins. Interacts with NOA1.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
SEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA*
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length recombinant corresponding to aa51-169 from MRPS27 (AAH30521) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in ascites fluid.
Specificity
Recognizes human MRPS27.
