129920-ML650
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™650Isotype
IgG1,kClone Number
1F2Grade
Affinity PurifiedApplications
FLISA IF WBCrossreactivity
HuAccession #
NM_000179, NP_000170Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-MSH6 (DNA Mismatch Repair Protein Msh6, hMSH6, G/T Mismatch-binding Protein, GTBP, GTMBP, MutS-alpha 160kD Subunit, p160, GTBP) (MaxLight 650)
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
The MSH6 gene located on chromosome 2p16 is one of the mismatch-repair genes involved in hereditary nonpolyposis colorectal cancer (HNPCC). It performs other functions in the cell, like binding to damaged DNA to initiate events that result in damage-induced cytotoxicity. It shares five conserved protein domains (designated I-V) in common with bacterial MutS. However unlike bacterial MutS or Msh2, Msh6 has an additional evolutionarily conserved region preceding domain I, comprised of from 100-more than 600aa, depending on the organism. These N-Terminal Regions (NTRs) of Msh6 contain short, conserved PIP (PCNA interacting protein) boxes near the N-terminus that interact with PCNA, the sliding clamp that participates in both DNA replication and DNA mismatch repair. It forms a heterodimer with MSH2 and is also a part of the BRCA1-associated genome surveillance complex (BASC). The pathological role of Msh6 has also been identified in endometrial cancer.
Applications
Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLK
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa931-1030 from human MSH6 (NP_000170) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MSH6.