Mouse Anti-MSK1 (Ribosomal Protein S6 Kinase alpha-5, S6K-alpha-5, 90kD Ribosomal Protein S6 Kinase 5, Nuclear Mitogen- and Stress-activated Protein Kinase 1, RSK-like Protein Kinase, RSKL, RPS6KA5) (MaxLight 550)
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
MSK1 is a dual kinase domain protein that acts downstream of the ERK1/2 and p38 MAPK signalling pathways. MSK1 phosphorylate the transcription factors CREB and ATF1, and the chromatin proteins histone H3 and HMGN1 in response to either mitogenic stimulation or cellular stress. MSK1 activity is tightly regulated in cells, and activation requires its phosphorylation by either ERK1/2 or p38alpha. This result in activation of the C-terminal kinase domain, which then phosphorylates further sites in MSK1, leading to the activation of the N-terminal kinase domain and phosphorylation of substrates. The protein contains two complete nonidentical protein kinase domains. The protein is widely expressed in human brain, heart, and placenta. Human MSK1 gene is mapped to chromosomal region 14q31-q32.1.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
ILKSEPPYPQEMSALAKDLIQRLLMKDPKKRLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYSPAALPQSSEK
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa271-370 from RPS6KA5 (AAH17187) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human RPS6KA5.
