Rabbit Anti-Myoglobin (MB) (Not for Export EU)
Myoglobin is a cytoplasmic single chain polypeptide that contains a single heme group and functions as an oxygen transporting pigment. It is found in skeletal and cardiac muscle but not smooth muscle. This antibody does not recognize hemoglobin and may help in detecting tissues of striated muscle origin.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human MB, aa1-154 (NP_005359.1).
Form
Supplied as a liquid.
Specificity
Recognizes human MB.