130094-FITC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
FITCIsotype
IgG2a,kClone Number
1E8Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
NM_021245, NP_067068.1Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-MYOZ1 (Myozenin 1, Myozenin-1, Calsarcin-2, MYOZ Filamin-, actinin- and telethonin-binding Protein, Protein FATZ) (FITC)
Myozenins may serve as intracellular binding proteins involved in linking Z-disk proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere. MYOZ (Myozenin 1) plays an important role in the modulation of calcineurin signaling. MYOZ1 may play a role in myofibrillogenesis. MYOZ1 interacts with ACTN2, ACTN3, FLNA, FLNB, FLNC, LDB3, PPP3CA and TCAP and interacts via its C-terminal region with MYOT. MYOZ1 is localized to the nucleus and pseudopodia of undifferentiated cells and detected throughout the myotubes of differentiated cells. MYOZ1 colocalizes with ACTN2, FLNC and MYOT at the Z-lines of skeletal muscle. MYOZ1 is expressed primarily in skeletal muscle and specifically enriched in the gastrocnemius, which is composed predominantly of fast-twitch muscle fibers.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEE
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa200-299 from human MYOZ1 (NP_067068) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MYOZ1.
