130103-Biotin
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
BiotinIsotype
IgG2b,kClone Number
4D8Grade
Affinity PurifiedApplications
E IHC WBCrossreactivity
HuAccession #
NM_006766, NP_006757Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-MYST3 (Histone Acetyltransferase KAT6A, MOZ, YBF2/SAS3, SAS2 and TIP60 Protein 3, MYST-3, Monocytic Leukemia Zinc Finger Protein, Runt-related Transcription Factor-binding Protein 2, Zinc Finger Protein 220, KAT6A, MOZ, RUNXBP2, ZNF220, MGC167033) (Biotin)
Histone acetyltransferases (HATs) have been implicated in a number of cellular functions including gene regulation, DNA synthesis, and repair. Histone acetyltransferases and deacetylases are respectively, the enzymes devoted to thr addition and removal of acetyl groups from lysine residues on the Histone N-terminal trails. The enzymes exert fundamental roles in developmental processes and their deregulation has been linked to the progression of diverse human disorders, including cancer.
Applications
Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested.
Recommended Dilution
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
ALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGK
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa81-180 from MYST3 (NP_006757) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MYST3.