130118-PE
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
PEIsotype
IgG2a,kClone Number
4H6Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
NM_199290, NP_954984Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
BSA Free
Mouse Anti-NACAL (NACA2, Nascent Polypeptide-associated Complex Subunit alpha-2, Alpha-NAC-like, Hom s 2.01, Nascent Polypeptide-associated Complex Subunit alpha-like, NAC-alpha-like) (PE)
Prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER). Binds to nascent polypeptide chains as they emerge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. Also reduces the inherent affinity of ribosomes for protein translocation sites in the ER membrane (M sites).
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Sandwich FLISA: The detection limit is ~3ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
ASDAYIVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKDVKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV*
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa116-216 from human NACAL (NP_954984) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human NACAL.