130129-FITC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
FITCIsotype
IgG2b,kClone Number
2C11Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
NM_024865, NP_079141Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-NANOG (Homeobox Protein NANOG, Homeobox Transcription Factor Nanog, hNanog, FLJ12581, FLJ40451) (FITC)
NANOG is a unique variant of NK2 family of transcription factors. It is a human ortholog of mouse Nanog and consists of a highly conserved homeodomain and Trp-rich repeats. It is specifically expressed by embryonic stem cells and is crucial for second embryonic lineage determination. It works in concert with OCT-4 and SOX-2 and plays a central role in regulating pluripotency and self-renewal of ICM and ES cells. It functions independent of LIF:gp130:Stat3 pathway and prevents differentiation of ES cells to extraembryonic endoderm and trophectoderm lineages. Its expression has also been detected in embryonic carcinoma cells and germ line tumors indicating a therapeutic intervention.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
TRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPM
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa98-196 from human NANOG (NP_079141) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human NANOG.
