130169-FITC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
FITCIsotype
IgG1,kClone Number
4C12Grade
Affinity PurifiedApplications
FLISA IF IHC WBCrossreactivity
HuAccession #
BC028182, AAH28182Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-NCAPD2 (CAPD2, CNAP1, KIAA0159, Condensin Complex Subunit 1, Chromosome Condensation-related SMC-associated Protein 1, Chromosome-associated Protein D2, hCAP-D2, Non-SMC Condensin I Complex Subunit D2, XCAP-D2 Homolog) (FITC)
Regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases. May target the condensin complex to DNA via its C-terminal domain.
Applications
Suitable for use in FLISA, Immunohistochemistry, Immunofluorescence and Western Blot. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
LRKMLDNFDCFGDKLSDESIFSAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSSGSRYQPLASTASDNDFVT
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1240-1339 from CNAP1 (AAH28182) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CNAP1.
