130199-HRP
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
HRPIsotype
IgG1,kClone Number
6A5Grade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
NM_016250, NP_057334Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-NDRG2 (Protein NDRG2, N-myc Downstream-regulated Gene 2 Protein, Protein Syld709613, KIAA1248, SYLD, DKFZp781G1938, FLJ25522) (HRP)
NDRG2 (NDRG family member 2) belongs to the N-myc downregulated gene family. It is a cytoplasmic protein which may be involved in dendritic cell and neuron differentiation. It is upregulated at both the RNA and protein levels in Alzheimer's disease. NDRG2 mRNA is downregulated or undetectable in several human cancers and cancer cell-lines, suggesting that it may have anti-tumor activity.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAP
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-97 from human NDRG2 (NP_057334) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human NDRG2.
