130398-ML550
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™550Isotype
IgG1,kClone Number
1E4-G5Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
BC025711, AAH25711Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-Nkx 2.5 (Homeobox Protein Nkx-2.5, Cardiac-specific, CSX, NK-2 Homolog E, NKX2.5, NKX2E, FLJ52202, FLJ97166, FLJ97195, FLJ97197, FLJ99536) (MaxLight 550)
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
NKX2.5 is a member of the NKX homeobox transcription factor family. NKX2.5 plays an essential role in heart development and is among the earliest factors expressed in cardiac lineage of developing embryos. Its targeted disruption in mice causes abnormal heart morphogenesis, severe growth retardation, and embryonic lethality around E9.5. Defects in NKX2.5 is associated with several forms of congenital heart diseases, such as atrial defect with atrioventricular conduction defects (ASD-AVCD) and tetralogy of Fallot (TOF). Transcription activation of NKX2.5 is also associated with certain B and T cell leukemias resultant from chromosomal translocation.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-324 from human NKX2-5 (AAH25711) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human NKX2-5.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
References
1. Complex SUMO-1 Regulation of Cardiac Transcription Factor Nkx2-5. Costa MW, Lee S, Furtado MB, Xin L, Sparrow DB, Martinez CG, Dunwoodie SL, Kurtenbach E, Mohun T, Rosenthal N, Harvey RP.PLoS One. 2011;6(9):e24812. Epub 2011 Sep 12. 2. RNA toxicity in myotonic muscular dystrophy induces NKX2-5 expression. Yadava RS, Frenzel-McCardell CD, Yu Q, Srinivasan V, Tucker AL, Puymirat J, Thornton CA, Prall OW, Harvey RP, Mahadevan MS.Nat Genet. 2008 Jan;40(1):61-8. Epub 2007 Dec 16.USBio References
No references available