Mouse Anti-NOTCH2NL (Notch Homolog 2 N-terminal-like Protein, N2N, FLJ35032, FLJ55807)
May function in the Notch signaling pathway and regulate neutrophil differentiation.
Applications
Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested.
Recommended Dilutions
Immunofluorescence: 10ug/ml Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGICLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN*
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length recombinant protein corresponding to aa1-237 from human NOTCH2NL (AAH19835) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human NOTCH2NL.
