NMDA receptors are a class of ionotropic glutamate receptors. NMDA receptor channel has been shown to be involved in long term potentiation, an activity dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B or NR2B), NMDAR2C (GRIN2C), and NMDAR2D (GRIN2D). GRIN2B may be a candidate gene for the neurodegenerative disorder dentato-rubro-pallidoluysian atrophy (DRPLA). Properties of NMDAR include modulation by glycine, inhibition by Zn2+, voltage dependent Mg2+ blockade and high Ca2+ permeability. The involvement of NMDAR in the CNS has become a focus area for neurodegenerative diseases such as Alzheimer's disease, epilepsy and ischemic neuronal cell death.

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

HGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEE

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa127-236 from human GRIN2B (NP_000825) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human GRIN2B.