130647-APC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
APCIsotype
IgG1,kClone Number
4A7-A6Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
BC033824, AAH33824Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
BSA Free
Mouse Anti-NUMB (Protein Numb Homolog, h-Numb, Protein S171, Protein S171) (APC)
Plays a role in the process of neurogenesis. Required throughout embryonic neurogenesis to maintain neural progenitor cells, also called radial glial cells (RGCs), by allowing their daughter cells to choose progenitor over neuronal cell fate. Not required for the proliferation of neural progenitor cells before the onset of neurogenesis. Also involved postnatally in the subventricular zone (SVZ) neurogenesis by regulating SVZ neuroblasts survival and ependymal wall integrity. May also mediate local repair of brain ventricular wall damage.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-135 from NUMB (AAH33824) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human NUMB.