Mouse Anti-OR2A2 (Olfactory Receptor 2A2, Olfactory Receptor 2A17, Olfactory Receptor OR7-11, OR2A17P, OR2A2P, OST008)
Odorant receptor.
Applications
Suitable for use in ELISA. Other applications not tested.
Recommended Dilution
Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
PDSNQREEQEKMLSLFHSVLNPMLNPLIYSLRNAQLKGALHRALQRKRSMRTVYGLCL*
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa261-319 from human OR2A2 (NP_001005480) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human OR2A2.
