Otopetrins are multi-transmembrane domain proteins that share conserved gene and protein structure and are possibly involved in the formation of otoconia and otoliths. Located in the utricle and saccule of the inner ear, otoconia are complex calcium carbonate biominerals that are required for the normal sensation of gravity and linear acceleration. Vertigo and loss of balance may be attributed to degeneration of displacement of otoconia. The otopetrin family consists of three proteins, OTOP1, OTOP2 and OTOP3. These proteins have 12 putative transmembrane domains that are clustered into three otopetrin domains (OD-I, II and III). OTOP1 was the first described member of the Otopetrin family. Mutations of OTOP1 leads to absence of otoconia or otoliths, though inner ear development is normal. OTOP2 and OTOP3 share significant structural similarity with OTOP1 and may also play a role in the formation of mineralized structures.

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

ESLHRGPPGAEPHSTHPKEPCQDLTFTNLDALHTLSACPPNPGLVSPSPSDQREAVAIVSTPRSQWRRQCL

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa423-494 from human OTOP2 (NP_835454) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.

Purified by Protein A affinity chromatography.

Recognizes human OTOP2.