130799-APC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
APCIsotype
IgG2a,kClone Number
3C10Grade
Affinity PurifiedApplications
FLISACrossreactivity
HuAccession #
BC002798, AAH02798Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
BSA Free
Mouse Anti-p40 phox (Neutrophil Cytosolic Factor 4, NCF4, MGC3810, NCF, NCF-4, Neutrophil cytosol factor 4, Neutrophil NADPH oxidase factor 4, P40PHOX, p40-phox, SH3 and PX domain-containing protein 4, SH3PXD4) (APC)
NCF4 is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2(NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity.
Applications
Suitable for use in FLISA. Other applications have not been tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQE
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-100 from human p40 phox with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human p40 phox.
