131005-FITC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
FITCIsotype
IgG2a,kClone Number
4A4Grade
Affinity PurifiedApplications
FLISA IF WBCrossreactivity
HuAccession #
NM_015889, NP_056973Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-MED15 (PCQAP, Mediator of RNA Polymerase II Transcription Subunit 15, Mediator Complex Subunit 15, Positive Cofactor 2 Glutamine/Q-rich-associated Protein, PC2 Glutamine/Q-rich-associated Protein, TPA-inducible Gene 1 Protein, TIG-1, Activator-recruited Cofactor 105kD Component, ARC105, CTG rEpeat Protein 7a, Trinucleotide Repeat-containing Gene 7 Protein, ARC105, CTG7A, TIG1, TNRC7, DKFZp686A2214, DKFZp762B1216, FLJ42282, FLJ42935) (FITC)
PCQAP is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome.
Applications
Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSL*
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-89 from human PCQAP (NP_056973) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human PCQAP.
