131011-APC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
APCIsotype
IgG2a,kClone Number
2D6Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
NM_002570, NP_002561Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
BSA Free
Mouse Anti-PCSK6 (PACE4, Proprotein Convertase Subtilisin/Kexin Type 6, Paired Basic Amino Acid Cleaving Enzyme 4, Subtilisin-like Proprotein Convertase 4, SPC4, Subtilisin/Kexin-like Protease PACE4) (APC)
PACE4 is a Serine S8 type protease that cleaves precursor proteins at paired basic amino acid processing sites. Several PACE4 substrates have been identified, including transforming growth factor beta-related proteins, proalbumin and von Willebrand factor. At least eight alternatively spliced transcript variants encoding different isoforms have been reported. In mouse, PACE4 has been shown to increase tumor cell invasiveness, and thus enhance tumor progression.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa860-970 from human PCSK6 (NP_002561) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human PCSK6.
