Mouse Anti-PDE2A (cGMP-dependent 3',5'-cyclic Phosphodiesterase, Cyclic GMP-stimulated Phosphodiesterase, CGS-PDE, cGSPDE)
Phosphodiesterase 2A is a cGMP stimulated, cAMP/cGMP dual-specific phosphodiesterase whose hydrolytic activity is stimulated by the presence of cGMP binding to the GAF domain. PDE2A has been implicated in penile erectile dysfunction and in the regulation of fluid and inflammatory cell transit across the endothelial cell barrier (i.e., venous and capillary). PDE2A activity is inhibited by erythro-9-(2-hydroxyl-3-nonyl)adenine (EHNA). At least three isoforms have been reported (PDE2A1, PDE2A2, and PDE2A3).
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
REKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDA
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa850-940 from human PDE2A (NP_002590) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human PDE2A.
