The platelet-derived growth factor (PDGF) family consists of four disulfide-linked homodimers and one heterodimer (PDGF-AB). These proteins regulate diverse cellular functions through interactions with PDGF Ra and Rb. Mature PDGF-DD associates with PDGF Rb and triggers signaling through PDGF Rb homodimers and PDGF Ra/b heterodimers. The human PDGF-DD cDNA encodes a 370aa precursor that includes a 23aa signal sequence, one CUB domain, and one PDGF/VEGF domain. The PDGF/VEGF domain shares 27-35aa sequence identity with the corresponding regions of other PDGF family members. Human PDGF-DD shares 87aa sequence identity with mouse and rat PDGF-DD. PDGF-DD is secreted as a100kD latent homodimer which is activated by proteolysis to release a 35kD bioactive protein containing the PDGF/VEGF homology domain. A splice variant of PDGF-DD has a 6aa deletion near the N-terminus. A 72aa deletion within the PDGF/VEGF domain generates an inactive protein in mouse but has not been detected in human. PDGF-DD is widely expressed in embryonic and adult tissues, and PDGF Rb is expressed in a generally complementary pattern. PDGF-DD functions as a growth factor for renal artery smooth muscle cells and lens epithelial cells, and as a macrophage chemoattractant. PDGF-DD is overexpressed in and contributes to several disease states, including renal and hepatic fibrosis, mesangial proliferative glomerulopathy, pulmonary lymphoid infiltration, and many cancers. PDGF-DD functions in both paracrine and autocrine manners.

Suitable for use in FLISA and Immunoprecipitation. Other applications not tested.

Optimal dilutions to be determined by the researcher.

TPQSASIKALRNANLRRDDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDISETSTIIRGR

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa24-123 from human PDGFD with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.

Purified by Protein A affinity chromatography.

Recognizes human PDGFD.