Mouse Anti-PGK1 (PGKA, Phosphoglycerate Kinase 1, Cell Migration-inducing Gene 10 Protein, Primer Recognition Protein 2, MGC117307, MGC142128, MGC8947)
Also known as ATP:3-phosphoglycerate 1-phosphotransferase (EC 2.7.2.3), this major enzyme in glycolysis catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate, generating one molecule of ATP. New blood vessel formation or angiogenesis is critical for tumor expansion and metastasis. Lay et al. (2000) showed that the plasmin reductase isolated from conditioned medium of fibrosarcoma cells is the glycolytic enzyme phosphoglycerate kinase. They concluded that phosphoglycerate kinase not only functions in glycolysis but is secreted by tumor cells and participates in the angiogenic process as a disulfide reductase.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
SKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa321-418 from human PGK1 (NP_000282) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human PGK1.